PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G009900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 557aa    MW: 61088.6 Da    PI: 4.8449
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G009900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-183986148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT  Ede+l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Manes.11G009900.1.p 39 KGPWTSAEDEILIEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                         79******************************************9986 PP

2Myb_DNA-binding53.65e-1792135146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
  Manes.11G009900.1.p  92 KGSFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4013486IPR017930Myb domain
SuperFamilySSF466891.09E-3038133IPR009057Homeodomain-like
SMARTSM007173.1E-163888IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-244093IPR009057Homeodomain-like
CDDcd001671.08E-124186No hitNo description
PfamPF139219.3E-1742102No hitNo description
PROSITE profilePS5129426.81987141IPR017930Myb domain
SMARTSM007171.8E-1791139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2694140IPR009057Homeodomain-like
CDDcd001671.00E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MRHTKNESDD GVLSKDQTES LLAEEGSCGG SANGLMLKKG PWTSAEDEIL IEYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGSFTQEEE QLIIELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVSLQASYES QLSLNISGIY SGDKDHQDLL  180
QTNSYEIPEV IFDSLKANHG ISSYVPELPV ITASSMLMRG LSSSQYSNFM SPTVHCQKHL  240
RESTTLIPGY SGSGKTEFTL SDQFQHNSCD RVAQSFGLSF PFHLDPTNKN PESFGGNQVS  300
HILANGNFSA SKPNYGFVKM ELPSFQYPEN DLGSWGISPP RLLEIIDTLN QSTPIGTVES  360
SPHNSGLLDA LLHESETLSS TKNHSSDKSS NSSIVTHGEL AESSALNICN TEWEEYGDTL  420
SSLGHTTTSL FGECTPISTC GSSMDEPSAT ETLTGSNVKL TAVDQARSSE REKETTTRLD  480
ITHPDALLAS DWLEDGSGYV EDQDFMLDNI APLLSDDFSS DFEQMSTGAS TSNQGWGLGS  540
CAWNSMPAVC QMSELT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-33371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068750.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068751.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068752.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067L7W60.0A0A067L7W6_JATCU; MYB family protein
STRINGPOPTR_0003s18900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-139myb domain protein 33